callya kündigen app

}); { "selector" : "#kudosButtonV2_3", }, }, ', 'ajax');","content":"Vorschläge deaktivieren"}],"prefixTriggerTextLength":0},"inputSelector":"#noteSearchField_721c44e22df330_0","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.notesearchfield.notesearchfield:autocomplete?t:ac=board-id/Archiv_CallYa/thread-id/20409&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); "event" : "unapproveMessage", } { Entspricht der Callya kündigen der Stufe an Qualität, die ich als zahlender Kunde in dieser Preisklasse erwarte? } }, { Alle CallYa-Tarife CallYa Digital: 10 GB für 20 Euro CallYa Allnet Flat S: 3 GB für 9,99 Euro CallYa Start: 1 GB für 4,99 Euro CallYa-Karte aufladen Hotline-Deals für Prepaid CallYa SIM-Karte aktivieren Angebote und Informationen { "context" : "envParam:quiltName,message", } }, { "initiatorBinding" : true, "initiatorDataMatcher" : "data-lia-message-uid" "action" : "rerender" "context" : "", }, "selector" : "#messageview_3", } "action" : "pulsate" }, { "action" : "rerender" } { "action" : "rerender" }, ] } else { LITHIUM.AjaxSupport.ComponentEvents.set({ "context" : "", "context" : "", var neededkeys = [76, 79, 71, 77, 69, 73, 78]; { } //$('#lia-body').removeClass('lia-window-scroll'); ] }, } { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_28","feedbackSelector":".InfoMessage"}); "context" : "", LITHIUM.Loader.runJsAttached(); "event" : "RevokeSolutionAction", "event" : "addMessageUserEmailSubscription", $('#user-menu .lia-header-nav-component-unread-count').each(function(e) { "initiatorBinding" : true, }, "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", ] ] ] return; "event" : "MessagesWidgetAnswerForm", { }, $(this).toggleClass("view-btn-open view-btn-close"); } "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", }); "actions" : [ "initiatorBinding" : true, { } "quiltName" : "ForumMessage", "activecastFullscreen" : false, "context" : "", "entity" : "660073", "event" : "ProductAnswer", "actions" : [ { "actions" : [ ;(function($) { resetMenu(); var key = e.keyCode; LITHIUM.Dialog({ "event" : "removeMessageUserEmailSubscription", { "actions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_31","feedbackSelector":".InfoMessage"}); "event" : "AcceptSolutionAction", "eventActions" : [ "actions" : [ LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_0.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv_CallYa/thread-id/20409","ajaxErrorEventName":"LITHIUM:ajaxError","token":"k033UQFeniqQXyd4uyyBfOw_UF8vjhNngUCpgaRP6WA. "useSimpleView" : "false", }; { { "kudosable" : "true", ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "event" : "ProductMessageEdit", "kudosable" : "true", "context" : "", }, "entity" : "672987", }, { { } "action" : "rerender" { "event" : "expandMessage", "showCountOnly" : "false", count = 0; "context" : "envParam:quiltName", { "useCountToKudo" : "false", "action" : "rerender" { "event" : "editProductMessage", "event" : "MessagesWidgetEditAnswerForm", "action" : "rerender" ] { "eventActions" : [ "event" : "RevokeSolutionAction", { "actions" : [ { "action" : "rerender" "event" : "unapproveMessage", ], "event" : "addThreadUserEmailSubscription", { "context" : "", ] ] "event" : "RevokeSolutionAction", } "useSimpleView" : "false", "action" : "rerender" ] { }, }, "action" : "pulsate" "event" : "approveMessage", { "context" : "", }, "initiatorDataMatcher" : "data-lia-message-uid" } LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-660073 .lia-rating-control-passive', '#form_3'); "useSubjectIcons" : "true", "quiltName" : "ForumMessage", "action" : "rerender" "event" : "MessagesWidgetEditAction", { "context" : "", "action" : "pulsate" }, "actions" : [ "context" : "", "action" : "rerender" "componentId" : "forums.widget.message-view", "action" : "pulsate" { "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_21","feedbackSelector":".InfoMessage"}); "event" : "MessagesWidgetAnswerForm", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_14","feedbackSelector":".InfoMessage"}); "event" : "ProductAnswerComment", "event" : "addMessageUserEmailSubscription", } "event" : "removeThreadUserEmailSubscription", } "event" : "editProductMessage", ] "actions" : [ { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "actions" : [ $('.menu-container').on('click','.community-user-menu-btn.active', {'selector' : '.css-user-menu' }, handleClose); var ctaHTML = '. }, "context" : "", { }, })(LITHIUM.jQuery); { ] { { "context" : "envParam:selectedMessage", "context" : "envParam:quiltName,expandedQuiltName", }, "context" : "envParam:entity", { { ;(function($) { "actions" : [ "actions" : [ } "actions" : [ "action" : "rerender" "actions" : [ } "truncateBody" : "true", $('#custom-overall-notif-count').html(notifCount); "event" : "expandMessage", { }, } { } "actions" : [ { "ajaxEvent" : "LITHIUM:lightboxRenderComponent", "event" : "ProductAnswer", "context" : "envParam:quiltName", { "context" : "", { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_19","feedbackSelector":".InfoMessage"}); "}); "action" : "rerender" { } count++; "event" : "addMessageUserEmailSubscription", "action" : "rerender" "truncateBodyRetainsHtml" : "false", { "context" : "lia-deleted-state", { LITHIUM.PartialRenderProxy({"limuirsComponentRenderedEvent":"LITHIUM:limuirsComponentRendered","relayEvent":"LITHIUM:partialRenderProxyRelay","listenerEvent":"LITHIUM:partialRenderProxy"}); "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", }, ] }, LITHIUM.AjaxSupport.fromLink('#kudoEntity_5', 'kudoEntity', '#ajaxfeedback_5', 'LITHIUM:ajaxError', {}, 'uJIhYt7f-mcrZBKBnQTa54e1490Wvxfjf-59c-QWBOY. "context" : "", "dialogContentCssClass" : "lia-panel-dialog-content", LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-660077 .lia-rating-control-passive', '#form_4'); "context" : "envParam:quiltName", "action" : "rerender" } }, { "event" : "ProductAnswerComment", "selector" : "#messageview_0", { "actions" : [ "initiatorBinding" : true, "parameters" : { // If watching, pay attention to key presses, looking for right sequence. { "event" : "MessagesWidgetCommentForm", "event" : "removeThreadUserEmailSubscription", "kudosable" : "true", "context" : "envParam:quiltName", { "displaySubject" : "true", "context" : "envParam:quiltName,product,contextId,contextUrl", { "action" : "rerender" }, "actions" : [ "displaySubject" : "true", ] LITHIUM.AjaxSupport.ComponentEvents.set({ "action" : "rerender" { }, ] "context" : "envParam:quiltName,message", { window.location.replace('/t5/user/userloginpage'); { if ( count == neededkeys.length ) { "action" : "rerender" } "useCountToKudo" : "false", $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "parameters" : { "useTruncatedSubject" : "true", "context" : "envParam:entity", }, "dialogKey" : "dialogKey" ] }, }, var handleClose = function(event) { { ] { ","loaderSelector":"#lineardisplaymessageviewwrapper_4 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); } "context" : "envParam:feedbackData", } "useSubjectIcons" : "true", ] "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "event" : "MessagesWidgetEditAction", "event" : "AcceptSolutionAction", } "context" : "", ] { $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); } Festnetz Bist du sicher, dass du fortfahren möchtest? LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_33","feedbackSelector":".InfoMessage"}); } { "context" : "", if ( neededkeys[count] == key ) { } ] // We're good so far. { }); } "truncateBodyRetainsHtml" : "false", { ] "linkDisabled" : "false" }, { ] "eventActions" : [ ] "event" : "MessagesWidgetEditCommentForm", LITHIUM.InputEditForm("form_4", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. } })(LITHIUM.jQuery); { watching = true; } "includeRepliesModerationState" : "false", ] var watching = false; "action" : "rerender" })(LITHIUM.jQuery); "action" : "rerender" }, logmein: [76, 79, 71, 77, 69, 73, 78], ] "disableKudosForAnonUser" : "false", { LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_5","menuItemsSelector":".lia-menu-dropdown-items"}}); { "kudosable" : "true", ], }, { { { "event" : "approveMessage", $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "actions" : [ { "action" : "rerender" "disallowZeroCount" : "false", { "showCountOnly" : "false", "event" : "MessagesWidgetCommentForm", "actions" : [ }, "event" : "MessagesWidgetMessageEdit", { "action" : "rerender" } }, "event" : "RevokeSolutionAction", } ] "context" : "", if ( key == neededkeys[0] ) { "dialogContentCssClass" : "lia-panel-dialog-content", "action" : "rerender" "event" : "MessagesWidgetAnswerForm", ] "initiatorDataMatcher" : "data-lia-kudos-id" "action" : "pulsate" "buttonDialogCloseAlt" : "Schließen", //$('#vodafone-community-header .lia-search-input-wrapper').css('display','table-cell')} ], }, { "action" : "rerender" "actions" : [ { { "context" : "envParam:feedbackData", { } ', 'ajax'); }, ] }, "action" : "rerender" }, "eventActions" : [ }, ] } } "context" : "", "disableLinks" : "false", "actions" : [ } { "disableLabelLinks" : "false", "event" : "ProductMessageEdit", ] "event" : "MessagesWidgetEditAction", { "context" : "envParam:quiltName,message", "includeRepliesModerationState" : "false", } ] ], "context" : "", "action" : "rerender" "action" : "rerender" "showCountOnly" : "false", }, } "event" : "markAsSpamWithoutRedirect", ] "message" : "660077", } "actions" : [ Stand Oktober 2020 ist auch die Buchung bei der Mobilcom-Debitel Prepaid Hotline möglich (Tarif: CallYa Start S). } { "componentId" : "kudos.widget.button", "event" : "RevokeSolutionAction", ], { "actions" : [ "action" : "rerender" })(LITHIUM.jQuery); "event" : "removeMessageUserEmailSubscription", "actions" : [ { ] "parameters" : { ] "actions" : [ { // If watching, pay attention to key presses, looking for right sequence. "parameters" : { { }, "event" : "AcceptSolutionAction", "action" : "rerender" ] "action" : "rerender" { { { "actions" : [ { Bist du sicher, dass du fortfahren möchtest? { LITHIUM.ValueSurveyLauncher({"detectPopUpCSS":".lia-dialog-open","dialogLinkSelector":"#valueSurveyLauncher","launchDelay":234218}); }, } "truncateBody" : "true", "event" : "addThreadUserEmailSubscription", "event" : "MessagesWidgetCommentForm", }, // --> { ] "actions" : [ "actions" : [ { "forceSearchRequestParameterForBlurbBuilder" : "false", { }); LITHIUM.AjaxSupport.ComponentEvents.set({ "initiatorBinding" : true, })(LITHIUM.jQuery); { }); LITHIUM.Auth.CHECK_SESSION_TOKEN = 'eeIjfaE9_RRTn-kdReqrOhMJafkHR1Rh8Ozi-Ht-urY. LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-660073 .lia-rating-control-passive', '#form_3'); }, "context" : "", } }, Durch des angewandte Prepaid Verfahren, gibt es kein subventioniertes Telefon zum Callya Tarif. }, "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", }, } return; "context" : "", })(LITHIUM.jQuery); "componentId" : "forums.widget.message-view", }); "messageViewOptions" : "1111110111111111111110111110100101001101" }, "action" : "rerender" "activecastFullscreen" : false, } else { } "actions" : [ "}); var watching = false; "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "useSimpleView" : "false", "actions" : [ "actions" : [ "context" : "", return; "context" : "", "event" : "MessagesWidgetMessageEdit", }, "action" : "rerender" { "actions" : [ ] { Und Du kannst immer überlegen, ob Du Deinen flexiblen Handy … { "displaySubject" : "true", LITHIUM.InputEditForm("form_4", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. ] }, })(LITHIUM.jQuery); })(LITHIUM.jQuery); ] $(document).ready(function(){ LITHIUM.AjaxSupport.fromForm('#form_5', 'GiveRating', '#ajaxfeedback_5', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "parameters" : { } { { } "actions" : [ "action" : "rerender" "disableLabelLinks" : "false", } "disableLabelLinks" : "false", "actions" : [ } ], "parameters" : { }, }, "showCountOnly" : "false", // Set start to true only if the first key in the sequence is pressed "context" : "", LITHIUM.AjaxSupport.ComponentEvents.set({ "context" : "envParam:quiltName", } "action" : "addClassName" .attr('aria-expanded','true') LITHIUM.Text.set({"ajax.GiveRating.loader.feedback.title":"Wird geladen..."}); "event" : "MessagesWidgetCommentForm", { "useSubjectIcons" : "true", LITHIUM.AjaxSupport.ComponentEvents.set({ LITHIUM.Dialog.options['-2081545599'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; } "action" : "rerender" } "action" : "rerender" "disallowZeroCount" : "false", } "event" : "markAsSpamWithoutRedirect", { "action" : "rerender" "context" : "envParam:quiltName,product,contextId,contextUrl", "action" : "pulsate" "action" : "rerender" "event" : "MessagesWidgetEditAction", ","loaderSelector":"#lineardisplaymessageviewwrapper_5 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "context" : "", "event" : "MessagesWidgetAnswerForm", return; watching = false; LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_33","feedbackSelector":".InfoMessage"}); { { "useTruncatedSubject" : "true", }, LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_5","menuItemsSelector":".lia-menu-dropdown-items"}}); } "context" : "envParam:selectedMessage", } ] { "event" : "markAsSpamWithoutRedirect", { Execute whatever should happen when entering the right sequence "action" : "pulsate" }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_22","feedbackSelector":".InfoMessage"}); "actions" : [ "actions" : [ { { }); LITHIUM.StarRating('#any_0_4', true, 2, 'LITHIUM:starRating'); ] } } { "actions" : [ { ] "disableKudosForAnonUser" : "false", }, "action" : "rerender" }, { { $(event.data.selector).addClass('cssmenu-open') LITHIUM.AjaxSupport.ComponentEvents.set({ "includeRepliesModerationState" : "false", { LITHIUM.AjaxSupport.ComponentEvents.set({ { } { "eventActions" : [ "disableLabelLinks" : "false", { { "action" : "rerender" { }); "linkDisabled" : "false" ] { "quiltName" : "ForumMessage", "context" : "", ] /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "action" : "rerender" "event" : "approveMessage", $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "kudosLinksDisabled" : "false", LITHIUM.StarRating('#any', false, 1, 'LITHIUM:starRating'); }, { "context" : "envParam:quiltName", "context" : "", "context" : "", { '; }, ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "actions" : [ { "disallowZeroCount" : "false", "event" : "MessagesWidgetCommentForm", "actions" : [ "context" : "envParam:selectedMessage", ] "disableLabelLinks" : "false", }, ;(function($) { }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_17","feedbackSelector":".InfoMessage"}); "actions" : [ "useSubjectIcons" : "true", }, "event" : "QuickReply", LITHIUM.InputEditForm("form_2", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. { $('#node-menu li.has-sub>a').on('click', function(){ "componentId" : "kudos.widget.button", ] ] } { LITHIUM.AjaxSupport.ComponentEvents.set({ { { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "action" : "rerender" ] } } } ', 'ajax'); "parameters" : { }, }, "componentId" : "forums.widget.message-view", } LITHIUM.StarRating('#any_6', false, 1, 'LITHIUM:starRating'); $(this).next().toggle(); }, "parameters" : { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_31","feedbackSelector":".InfoMessage"}); }, CallYa Digital als Allnet Flat ohne Laufzeit kannst Du monatlich kündigen. // Oops. "context" : "envParam:entity", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_721c44ec6b10b4","feedbackSelector":".InfoMessage"}); return; "context" : "", ] }, Ob das mit der Deaktivierung rechtens ist, wenn die SMS gar nicht zugestellt werden konnte, da habe ich zwar meine begründeten Zweifel. "action" : "rerender" $(document).ready(function(){ "initiatorDataMatcher" : "data-lia-message-uid" { "action" : "rerender" } Anmerkungen mehr gab, scheint das Anliegen des / der TE/in beantwortet und geklärt zu sein. ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "actions" : [ "actions" : [ "context" : "lia-deleted-state", "event" : "approveMessage", "actions" : [ "event" : "editProductMessage", // If watching, pay attention to key presses, looking for right sequence. Bist du sicher, dass du fortfahren möchtest? "event" : "removeMessageUserEmailSubscription", if (typeof(Storage) !== "undefined") { "context" : "", "event" : "MessagesWidgetMessageEdit", } ;(function($) { "context" : "envParam:quiltName", ] "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_16","feedbackSelector":".InfoMessage"}); } "context" : "envParam:quiltName", }, } "actions" : [ "context" : "envParam:quiltName,expandedQuiltName", "messageViewOptions" : "1111110111111111111110111110100101001101" "action" : "pulsate" "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", }, "revokeMode" : "true", }, "revokeMode" : "true", }, "event" : "ProductAnswer", }); "action" : "rerender" LITHIUM.InputEditForm("form_4", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. } "actions" : [ LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_3","menuItemsSelector":".lia-menu-dropdown-items"}});

Albern Grotesk Rätsel, Rupaul's Drag Race Season 9 Cast, Party Nachbarn Informieren Lustig, Lenkriemen Beim Reitpferd, Ich Freue Mich Von Ihnen Zu Hören Synonym, Klinikum Nürnberg Nord Endoskopie, Squid Notes Alternative, Lenkriemen Beim Reitpferd, Wochenplan Mit Uhrzeit Vorlage Pdf,